Founding fathers images Freedom Fighters. Raised in a well-to-do family with six sisters and one brother, he was afforded an Images. father's day. Digital restoration by Steven Wynn Photography. declaration of independence - the four founding fathers stock pictures, royalty-free photos & images. Browse 2,731 authentic founding fathers stock photos, high-res images, and pictures, or explore additional fathers day or father and son stock images to find the right photo at the right size and resolution for your project. 6. baby. - founding fathers declaration of independence stock The bronze statue is 9 feet high set upon a 12 foot high pedestal. Categories. Thousands of new, high-quality pictures added every day. " founding fathers stock pictures, royalty-free photos & images. Download and use 10,000+ Founding Fathers stock photos for free. thomas jefferson by rudolph evans - founding fathers statue stock pictures, royalty-free photos & images. Find Founding Fathers Of The United States stock photos and editorial news pictures from Getty Images. An illustration of a heart shape "Donate to the archive" An illustration of a person Jefferson's sons : a founding father's secret children by Bradley, Kimberly Brubaker, author. More. By using this Browse 428 authentic founding fathers painting stock photos, high-res images, and pictures, or explore additional declaration of independence or ben franklin stock images to find the right photo at the right size and resolution for your project. Explore. american founding fathers stock pictures, royalty-free photos & images Jefferson Memorial in DC Washington DC, USA - April 7, 2015: Tourists admire the bronze statue of Thomas Jefferson inside the Jefferson Memorial. The Pierce Archive. Us Founding Fathers stock photos are available in a variety of sizes and formats to fit your needs. The painting Signing the Constitution of the United Explore Authentic Founding Fathers Of The United States Stock Photos & Images For Your Project Or Campaign. Find "founding Fathers" stock images in HD and millions of other royalty-free stock photos, illustrations and vectors in the Shutterstock collection. Search from thousands of royalty-free Founding Fathers stock images and video for your next project. Mar 12, 2017 · Find Founding Fathers Of The United States stock images in HD and millions of other royalty-free stock photos, illustrations and vectors in the Shutterstock collection. appointment of george washington to the presidency - american founding fathers stock illustrations. 4 Sound sound Year 2009 . Browse 230 beautiful Founding Fathers stock images, photos and wallpaper for royalty-free download from the creative contributors at Vecteezy! The Founding Fathers And Hemp. Thomas Paine was a Founding Father, a philosopher of the American Revolution, and a true revolutionary. Vintage Decorative Map of USA (XXXL Resolution Image) "Antique decorative map of the United States of America in XIX century with decorative vignettes and portraits. Find Founding Fathers stock images in HD and millions of other royalty-free stock photos, illustrations and vectors in the Shutterstock collection. Find Founding Father stock images in HD and millions of other royalty-free stock photos, 3D objects, illustrations and vectors in the Shutterstock collection. Reviews Reviews cannot be added to this item. Buy Founding Fathers: A Captivating Guide to Benjamin Franklin, George Washington, John Adams, Thomas Jefferson, John Jay, James Madison, View high quality images that let you zoom in to take a closer look. Find "founding Father" stock images in HD and millions of other royalty-free stock photos, illustrations and vectors in the Shutterstock collection. Thomas Search from Founding Father Pictures stock photos, pictures and royalty-free images from iStock. Signing of the Constitution of the USA. The move comes after viral social posts showed the AI tool overcorrecting for diversity, producing “historical” images of Nazis, America’s Founding Fathers and the Pope as people of color. Even Columbus used Hemp extensively in his three ships that reached the new found land for the first time and at the time it is hard to think of another material that would have been strong enough to make the journey across the Atlantic. An icon used to represent a menu that can be toggled by interacting with this icon. - founding fathers of the united states stock pictures, royalty-free photos & images Download the perfect founding fathers pictures. Founding Fathers Wallpapers. Browse 428 authentic founding fathers painting stock photos, high-res images, and pictures, or explore additional declaration of independence or ben franklin stock images to find the right photo at the right size and resolution for your project. Founding Father Images. Browse 3,500+ founding fathers stock photos and images available, or search for fathers day or father and son to find more great stock photos and pictures. Files are available under licenses specified on their description page. Vector Founding Fathers illustrations available in a variety of sizes and formats to fit your needs. Search from Founding Fathers Declaration Of Independence stock photos, pictures and royalty-free images from iStock. 43 MB) This image is Thomas Jefferson was a founding father of the United States and served as the third President. Four of our countries men who fought for the freedom we enjoy today, Washington, Hamilton, Lincoln, and Franklin. pan left to right of mural depicting the founding fathers of the united states, george washington, thomas jefferson, etc. founding fathers stock pictures, royalty-free photos & images. More info: yarbs. child. Countless others, including Thomas . Google Gemini. Find Seven Founding Fathers stock images in HD and millions of other royalty-free stock photos, illustrations and vectors in the Shutterstock collection. The Verge and others caught Gemini generating images of racially diverse Nazis and US Founding Fathers if you prompt Gemini for images of a specific type of person — such as “a Black Find Founding Fathers Statues stock images in HD and millions of other royalty-free stock photos, illustrations and vectors in the Shutterstock collection. Browse Getty Images' premium collection of high-quality, authentic Vector Founding Fathers stock illustrations, royalty-free vectors, and high res graphics. Find America Founding Fathers stock images in HD and millions of other royalty-free stock photos, 3D objects, illustrations and vectors in the Shutterstock collection. us founding fathers stock pictures, royalty-free photos & images. Publication date 1994 Topics United States. Hemp was extremely important to early Americans. " art, americana, government buildings. I hope that viewers will now get the chance to see the American founding fathers' true likeness: George, Washington, John Adams, Thomas Jefferson, James Madison, and many other historical figures. Founding Fathers Images stock photos are available in a variety of sizes and formats to fit your needs. Founding Fathers Constitution stock photos are available in a variety of sizes and formats to fit your needs. Founding fathers images for free download. 8 Designs Search from thousands of royalty-free Founding Fathers stock images and video for your next project. Enjoy features only possible in digital – start reading right away, carry your library with you, Founding Fathers coloring pages. Search from Founding Father stock photos, pictures and royalty-free images from iStock. By Aristos Georgiou On 7/17/23 at 3:00 PM EDT America Is Worth Oct 20, 2020 · The intimate lives of the Founding Fathers by Fleming, Thomas J. Live The founding fathers by Meister, Charles W. 1K. Countless others, including Thomas Thomas Jefferson was a founding father of the United States and served as the third President. Publication date 1993 Topics Browse Getty Images' premium collection of high-quality, authentic Founding Fathers Images stock photos, royalty-free images, and pictures. dad. These founding fathers were instrumental in drafting the Declaration of Independence, the Constitution, and the Bill of Rights, which established the framework for the government Jan 11, 2019 · It gives the reader a context within which to explore the world of the founding fathers and their complex and still-controversial achievements and legacies"--Provided by publisher CHAPTER 1: Words, Images, Meanings; CHAPTER 2: Contexts: The History That Made the Founding Fathers; CHAPTER 3: Achievements and Challenges: The History the Apr 6, 2024 · Find Founding Fathers Statues stock images in HD and millions of other royalty-free stock photos, illustrations and vectors in the Shutterstock collection. Photos 14K Videos 5K Users 356. Explore Authentic Founding Fathers Stock Illustrations & Vectors For Your Project Or Campaign. Browse 27 four founding fathers photos and images available, or start a new search to explore more photos and images. Edit image. give me liberty or give me death - founding fathers stock illustrations. Upload Join. Search from Founding Fathers America stock photos, pictures and royalty-free images from iStock. 3K Videos 5K Users 83. Google paused its AI image-generator after Gemini depicted America's founding fathers and Nazi soldiers as Black. Find over 100+ of the best free founding fathers images. Delphimages Photo Creations. " founding fathers of the united states photos stock illustrations. Gemini responded with images of black and Native American individuals signing what Download and use 10,000+ Founding Father stock photos for free. Our Founding Fathers might be esteemed for getting the United States of America started, but they were still regular people, with all-too-human quirks, personality flaws and family Search from Founding Fathers Constitution stock photos, pictures and royalty-free images from iStock. Somewhat similar to The Republic of Rome, but with many modifications to suit the topic, including a completely different way of resolving elections and a more nuanced treatment of Issue cards (rather than simply Wars), plus novelties All the latest breaking news on Founding Fathers. Browse 2,769 authentic founding fathers stock photos, high-res images, and pictures, or explore additional fathers day or father and son stock images to find the right photo at the right size and resolution for your project. Check out this fantastic collection of Founding Fathers wallpapers, with 38 Founding Fathers background images for your desktop, phone or tablet. Publication date 2007 Topics Find the best Founding Fathers Wallpaper on GetWallpapers. - founding fathers stock videos & royalty-free footage old engraved illustration of benjamin franklin (1706-1790), alexander hamilton (1755-1804) and others discussing the conception of the united states constitution has a tea party in a garden in philadelphia - america founding fathers stock pictures, royalty-free photos & images Search from thousands of royalty-free Founding Fathers stock images and video for your next project. Browse 1,889 authentic us founding fathers stock photos, high-res images, and pictures, or explore additional declaration of independence or george washington stock images to find the right photo at the right size and resolution for your project. Their union, though short-lived, Browse 223 founding fathers constitution photos and images available, or start a new search to explore more photos and images. License. Find Uae Founding Fathers stock images in HD and millions of royalty-free photos, illustrations, and vectors on Shutterstock. For the first time, get 1 free month of iStock exclusive photos, illustrations, and more. This is being updated and maintained as two lists: "Signers of the Declaration of Independence" and "Patriots of the American Revolution" I received the book,"The Founding Fathers, The Men Behind the Nation," as a Christmas gift, a few years Other images Eoford created are of founding father Franklin (1705-1790), and the third president of the U. These images are in the public domain and no permission is required to use them. fathers day. We hope you enjoy our growing collection of HD images to use as a Browse 232 beautiful Founding Fathers History stock images, photos and wallpaper for royalty-free download from the creative contributors at Vecteezy! Gemini responded with pictures “featuring diverse individuals embodying the spirit” of the Founding Fathers, including one image of black and Native American individuals signing what appeared old engraved illustration of the signing of the united states declaration of independence occurred primarily on august 2, 1776 at the pennsylvania state house, independence hall in philadelphia, pennsylvania. declaration of independence - four founding fathers stock pictures, royalty-free photos & images. Upload. love. Less Searching, More Finding With Getty Images. If you have one of your own you’d like to share, send it to us and we’ll be happy to include it on our website. pans to text of the declaration of independence, focus on phrase "the pursuit of happiness. government, administered by the National Archives and Records Administration through the NHPRC, in partnership with the University of Virginia Press, which is hosting this website. An illustration of a heart shape "Donate to the archive" An illustration of a person's head and chest. The Declaration of Independence High-Resolution Declaration Image (1. After achieving independence, George Washington appointed Jefferson to serve as the first secretary of state. Find Founding Fathers United States stock images in HD and millions of other royalty-free stock photos, 3D objects, illustrations and vectors in the Shutterstock collection. Original digital painting by Joe Cicak of America's founding father and first president, George Washington. Jan 16, 2021 · Images. We offer historical research Find Founding Fathers stock images in HD and millions of other royalty-free stock photos, illustrations and vectors in the Shutterstock collection. - founding father stock pictures, royalty-free photos & images Browse 1,912 american founding fathers photos and images available, or start a new search to explore more photos and images. family. old engraved illustration of benjamin franklin (1706-1790), alexander hamilton (1755-1804) and others discussing the conception of the united states constitution has a tea party in a garden in philadelphia - founding fathers These images, along with that of our flag, are shown resting on a copy of The Declaration of Independence. Find Founding Fathers Constitution stock images in HD and millions of other royalty-free stock photos, illustrations and vectors in the Shutterstock collection. Cash. Royalty free stock photos. CLICK ON THE LINKS BELOW FOR HUNDREDS OF SIMILAR IMAGES:" founding fathers united states stock illustrations. Find Seven Founding Fathers Uae stock images in HD and millions of other royalty-free stock photos, illustrations and vectors in the Shutterstock collection. Park and donated to the city of Chicago by Joseph Medill in 1896. Image created in Photoshop using digital brushes to simulate classic 18th century portrait Shop for founding fathers wall art from the world's greatest living artists and iconic brands. father. Find high-quality stock photos that you won't find anywhere else. E. 9 Designs. Browse or use the filters to find your next picture for your project. Ad: Adobe Stock - Get 10 Free Images + Founding Father Images; old engraved illustration of benjamin franklin (1706-1790), alexander hamilton (1755-1804) and others discussing the conception of the united states constitution has a tea party in a garden in philadelphia - america founding fathers stock pictures, royalty-free photos & images These men and their accomplishments are talked about so much it’s hard to imagine some of them as living, breathing people. Find Founding fathers stock images in HD and millions of other royalty-free stock photos, illustrations and vectors in the Shutterstock collection. Select from premium American Founding Fathers images of the highest quality. Explore Authentic Founding Fathers Images Stock Photos & Images For Your Project Or Campaign. founding father of the us stock pictures, royalty-free photos & images. Two Soldiers in Uniforms on Horses from American Civil War on White Background. B. All pictures are free for commercial and personal use. Hacker has a date with Brennan in A Night at the Bones Museum, and Hannah and Browse Getty Images’ premium collection of high-quality, authentic Founding Fathers stock photos, royalty-free images, and pictures. Yet, they were here, and they weren’t just a face on money or a People: Images of Founding Fathers Rare Images of Early American People. Mountain Dreams. Sculpted by R. Publication date 1998 Topics Federalist, Constitutional history -- Oct 5, 2020 · Images. Find America's Founding Father stock images in HD and millions of other royalty-free stock photos, illustrations and vectors in the Shutterstock collection. man. Images of the nation's founding fathers. Download royalty-free stock photos, vectors, HD footage and more on Adobe Stock. Another showed a black man appearing to represent George Washington, in a white wig and wearing an Army uniform. Explore the beauty of colonial fashion and discover important details about these iconic historical figures. Appointment of George Washington to the presidency. More An illustration of The Whiz kids : the founding fathers of American business--and the legacy they left us by Byrne, John A. Portrait of President John Adams "This vintage engraving depicts the portrait of the second President of the United States, John Adams (1735 - 1826). Old engraved illustration of The signing of the United States Declaration of Independence occurred And while a query for pictures of “the Founding Fathers” returned group shots of almost exclusively white men who vaguely resembled real figures like Thomas Jefferson, a request for “a US Google debuted Gemini’s image generation tool last week. Free Founding Father Photos. It gives the reader a context within which to explore the world of the founding fathers and their complex and still-controversial achievements and legacies"--Provided by publisher CHAPTER 1: Words, Images, Meanings; CHAPTER 2: Contexts: The History That Made the Founding Fathers; CHAPTER 3: Achievements and Challenges: The History the The most famous portrait of the Founding Fathers of the United States is that committed to canvas by the 19th-century artist John Trumbull, depicting five Fathers presenting the Declaration of Independence to Images. Select from premium Founding Fathers Of The United States of the highest quality. All of these Founding Fathers background and pictures are for free download on Pngtree. Find America's Founding Fathers stock images in HD and millions of other royalty-free stock photos, illustrations and vectors in the Shutterstock collection. Download 100+ Royalty Free Founding Fathers Vector Images. Countless others, including Thomas Jefferson Search from Founding Fathers Of The United States stock photos, pictures and royalty-free images from iStock. The Adams Papers; The Papers of Benjamin Franklin; The Papers of Alexander Hamilton; The Selected Papers of John Jay Browse Getty Images’ premium collection of high-quality, authentic Founding Fathers Constitution stock photos, royalty-free images, and pictures. and with pen in hand about to write a letter, one might imagine, to a friend or associate. The Adams Papers; The Papers of Benjamin Franklin; The Papers of Alexander Hamilton; The Selected Papers of John Jay old engraved illustration of benjamin franklin (1706-1790), alexander hamilton (1755-1804) and others discussing the conception of the united states constitution has a tea party in a garden in philadelphia - founding fathers stock pictures, royalty-free photos & images Our restaurant is conveniently located near Tysons Corner Center off I-495 and near the Tysons Station on the Metro’s Silver Line, Founding Farmers Tysons is a full-service restaurant and bar open every day for breakfast, lunch, dinner and weekend brunch. The images went viral, embarrassing Google. Declaration of Independence. The list of the homes of America's Founding Fathers, with photos of the founders, maps, and notes. 8 Designs. An illustration of text ellipses. founding fathers of the united states stock pictures, royalty-free photos & images. Find Founding Fathers Color stock images in HD and millions of other royalty-free stock photos, illustrations and vectors in the Shutterstock collection. The best selection of Royalty Free Founding Fathers Vector Art, Graphics and Stock Illustrations. Inaccurate AI-generated images of Asian Nazis, black founding fathers, and female Popes created with Google's Gemini AI chatbot are 'unacceptable,' the company's CEO said. All founding fathers artwork ships within 48 hours and includes a 30-day money-back guarantee. Conde Nast. He was born on January 17, 1706 in Boston, Massachusetts. Internet Archive Audio. All structured data from the file namespace is available under the Creative Commons CC0 License; all unstructured text is available under the Creative Commons Attribution-ShareAlike License; additional terms may apply. Thousands of new images every day Completely Free to Use High-quality videos and images from Pexels. Search from Four Founding Fathers stock photos, pictures and royalty-free images from iStock. S. , 美国开国元勋（又称美国国父，Founding Fathers of the United States）是直接或间接对美国宪法产生重大影响的个人，包括《独立宣言》和《邦联条例》的起草和签署人，以及美利坚合众国制宪会议代表（包括起草人、签署人和未签署人）以及参与美国革命的领袖。 Nov 5, 2024 · Aside from being of the Founding Fathers of the United States, Franklin was a notable inventor and an early advocate for paper money. Publication date 2002 Topics The Founding Fathers Bar is the place Booth, Brennan and rest of Jeffersonian team often go to celebrate after solving a case. Declaration Of Indepen Edit image. A collection of the top 38 Founding Fathers wallpapers and backgrounds available for download for free. Founding Fathers Vector illustrations available in a variety of sizes and formats to fit your needs. old engraved illustration of the signing of the united states declaration of independence occurred primarily on august 2, 1776 at the pennsylvania state house, independence hall in philadelphia, pennsylvania. 20 Designs. Search from Founding Fathers Images stock photos, pictures and royalty-free images from iStock. The people on these pages are those who were in the vanguard of the founding of the United States. Search among 1,206 authentic founding fathers stock photos, high-definition images, and pictures, or look at other mount rushmore or independence hall stock images to enhance your presentation with the perfect visual. Save. Top Images Latest Pictures Categories Stock Photos Seasonal Photos. Filters. Browse Newsweek archives of photos, videos and articles on Founding Fathers. 135 Uae Founding Fathers photos for download. Additionally, he was the governor of Virginia. Bridgeman Images. . More An illustration of Founding Fathers : brief lives of the framers of the United States Constitution by Bradford, M. Benjamin Franklin (1705-1790), American polymath, one of the founding fathers of the United States of America (Image by Hidreley Diao) Benjamin Franklin (1705-1790) was a genius who excelled in many areas, ranging from politics to science and diplomacy. Founders Online is an official website of the U. The erosion of Jefferson's image in the American mind Access-restricted-item true Addeddate 2020-10-20 16:06:53 Boxid IA1972407 Camera USB PTP Class Camera Collection_set printdisabled External-identifier urn:oclc:record:1204327578 urn:lcp:intimatelivesoff0000flem Thomas Jefferson, one of the most influential Founding Fathers of the United States, was born on April 13, 1743, in Shadwell, Virginia. Benjamin Franklin is shown sitting with a sheaf of papers. RUSSIA-TOPKI,December 24,2023: stamp printed in USA,shows Abraham Baldwin (1754-1807 Mar 31, 2022 · Images. His essays and and anyone interested in American History with entries, articles, primary documents, videos, and images that provide a solid understanding of the growth and development of the United States. Other instances of celebrations include The Con Man in the Meth Lab, where Brennan, Booth, Angela, Hodgins, Cam, Clark and Sweets celebrates Booth's birthday. Browse Getty Images' premium collection of high-quality, authentic Founding Fathers Vector stock illustrations, royalty-free vectors, and high res graphics. He was one of the drafters and signers of the United States Declaration of Independence in 1776. 183 Designs. Vector Illustration of a raised fist in front of American The Founding Fathers were a group of prominent political leaders and statesmen who played a key role in the American Revolution and the founding of the United States. Browse Getty Images' premium collection of high-quality, authentic Founding Fathers stock photos, royalty-free images, and pictures. Founding Fathers stock photos are available in a variety of sizes and formats to fit your needs. It looks like your blocker is attempting to interfere with the intended operation of this site. Download and use 10,000+ The Founding Fathers stock photos for free. Free Founding Fathers Photos. Photos 14. Aug 19, 2020 · Cartoon artistic image of american revolution founding fathers doodle. Search from The Four Founding Fathers stock photos, pictures and royalty-free images from iStock. Pngtree provides you with 75 free hd Founding Fathers background images, photos, banners and wallpaper. Making History. Founding fathers : the essential guide to the men who made America. This page was last edited on 29 September 2024, at 11:55. Father Son Bicycle. Browse 27 the four founding fathers photos and images available, or start a new search to explore more photos and images. H. parent. Browse 586 authentic signing of the declaration of independence stock photos, high-res images, and pictures, or explore additional founding fathers or american flag stock images to find the right photo at the right size and resolution for Browse 239 founding fathers statue photos and images available, or start a new search to explore more photos and images. Browse Getty Images' premium collection of high-quality, authentic Us Founding Fathers stock photos, royalty-free images, and pictures. Each round, an article of the constitution is put up for consideration, which is either a Federalist, Anti-Federalist, Big State, or Small State issue. An illustration of a heart shape "Donate to the archive" An illustration of a person Soekarno : founding father of Indonesia, 1901-1945 by Hering, B. Another Post query for representative images of “the Founding Fathers in 1789″ was also far from reality. Royalty-free images. founding fathers statue stock pictures, royalty-free photos & images Jefferson Memorial in DC Washington DC, USA - April 7, 2015: Tourists admire the bronze statue of Thomas Jefferson inside the Jefferson Memorial. Despite being the wife of a Founding Father, Elizabeth Checkley's life remains largely in the shadows. Free Founding Fathers Us Feb 22, 2024 · Google's Gemini system seems to do something similar, taking a user's image-generation prompt (the instruction, such as "make a painting of the founding fathers") and inserting terms for racial May 24, 2021 · Images. , Jefferson, who was in office from 1801 to 1809. (Melvin Eustace), 1934-1993. net 3,868 Free images of Founding Fathers. Appendix. Search from Founding Fathers Photos stock photos, pictures and royalty-free images from iStock. Please credit the National Archives as the original source. Popular. These images, along with that of our flag, are shown resting on a copy of The Declaration of Independence. Search from thousands of royalty-free "Founding Fathers" stock images and video for your next project. Photos 14K Videos 5K Users 21. Browse 1,600+ founding fathers stock illustrations and vector graphics available royalty-free, or search for fathers day or father and son to find more great stock images and vector art. Addeddate 2021-04-04 04:07:38 color Identifier secrets-of-the-founding-fathers Scanner Internet Archive HTML5 Uploader 1. Images. Getty Images. - united states founding fathers stock pictures, royalty-free photos & images america founding fathers stock pictures, royalty-free photos & images. Like the other Founding Fathers, Jefferson also served as a politician in the House of Burgesses, the Continental Congress, and the House of Delegates. Win $100 My Account Upload Image. Free for commercial use No attribution required Copyright-free Search from United States Founding Fathers stock photos, pictures and royalty-free images from iStock. Download and use 100,000+ Founding Fathers Us stock photos for free. Benjamin Franklin was the oldest Signer at 70 years old. We have an extensive collection of amazing background images carefully chosen by our community. Find American Founding Fathers stock illustrations from Getty Images. comment. An illustration of a heart shape Donate. Photos. Free The Founding Fathers Photos. Published by J. The fifty-cent piece pictures Founding Father Benjamin Franklin. Pocket Change. More An illustration of Fame and the founding fathers : essays by Adair, Douglass. Tallis and Sons, London and New York, 1851. The goal here is to be the founding father with the most renown at the end of the game, which consists of the making of the US constitution. 913 Views Find American Founding Fathers stock images in HD and millions of other royalty-free stock photos, illustrations and vectors in the Shutterstock collection. He is considered one of the most important Founding Fathers of the United States. Search from Founding Fathers Pictures stock photos, pictures and royalty-free images from iStock. We have 63+ background pictures for you! Home. , Find Founding Fathers stock images in HD and millions of other royalty-free stock photos, illustrations and vectors in the Shutterstock collection. Enjoy coloring these intricate illustrations of the Founding Fathers, influential figures who helped shape American history. Secret Masonic symbols and and images are analyzed and uncovered in the layout and streets of Washington DC. Daughter of a prominent Boston minister, she married Samuel Adams in 1749. Statue of Benjamin Franklin at Lincoln Park in Chicago, IL "Statue of Benjamin Franklin at Lincoln Park in Chicago, IL. Google CEO Sundar These images, along with that of our flag, are shown resting on a copy of The Declaration of Independence. More An illustration of Founding_Fathers_-_Overview Run time 00:07:17 Series Founding Fathers Year 2014 Youtube-height 1080 Youtube-id 6fjkb3FThrg Youtube-n-entries 4376 Find Founding Fathers Of Uae stock images in HD and millions of other royalty-free stock photos, illustrations and vectors in the Shutterstock collection. George Washington Digitally Generated Portrait "George Washington Portrait. mqhvlrgflcvvhqygenagrvmlkyhhwmqypzixbjnzozezspxcsooyxlorzpez